PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR12G03840.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family GATA
Protein Properties Length: 245aa    MW: 26051.7 Da    PI: 10.5125
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR12G03840.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA48.98.8e-16101135135
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                      C +Cg+++Tp+WR+gp g  tLCnaCG+++r  +l
  LPERR12G03840.1 101 CLHCGSSETPQWREGPMGRGTLCNACGVRHRQGRL 135
                      99*****************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011411.76795131IPR000679Zinc finger, GATA-type
SMARTSM004019.0E-1495145IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.95E-1497158No hitNo description
Gene3DG3DSA:3.30.50.101.7E-1399133IPR013088Zinc finger, NHR/GATA-type
PfamPF003208.8E-14101135IPR000679Zinc finger, GATA-type
CDDcd002023.83E-13101157No hitNo description
PROSITE patternPS003440101126IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MGKSTLCNAC GVRLRAVGSL LDRPPPPPPA TTVSPPESPI WTPPNTGDIY LVRKIPPKLA  60
TRGAPNKNQS SPPPPPSPPS PAPAPKTTKA RKKKEKKKKT CLHCGSSETP QWREGPMGRG  120
TLCNACGVRH RQGRLLPEYR PKGSPTFIPA IHAANHRQVL KLRRQQSHRQ SINNQERAAV  180
NEQILQLQQQ VSPPPQEEPV AAAAGAGAGD GDGGGKRTSL DALLLEGPSA PLIVDGDADD  240
DILVS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19095RKKKEK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015620068.12e-60PREDICTED: vegetative cell wall protein gp1
TrEMBLA0A0D9XXA11e-177A0A0D9XXA1_9ORYZ; Uncharacterized protein
STRINGORGLA12G0039500.12e-60(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP72732646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32890.15e-29GATA transcription factor 9